<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5101 CA13557 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 93
2 AZT+ 3TC 27
3 D4T+ NVP+ 3TC 19
4 DDI+ SQV 36
5 NFV+ D4T 88
6 D4T+ NFV+ NVP 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, K20KT, E35D, M36I, R57K, L63P, I64V, V75I  
>CA13557| codons 1-99
PQITLWQRPLVTVKIGGQLTEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPVEICGHKAIGTILVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181C   I135T, G196E, Q197K, Q207E, V245T, E248D, A272P, K277R, T286A, V292I, E297K, A304G  
>CA13506| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEKHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIPLTKEAE
LELG

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005