<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5481 CA13556 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 65
3 AZT+DDC+SQV 65
4 D4T+DDI+NFV+NVP 4
5 D4T+DDI+NFV 35
6 3TC+AZT+IDV+RTV 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, I64V, A71V, T74S, V77I  
>CA13556| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFTKVRQYD
QILVEICGHKVIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219Q     T39N, E44D, K122E, E203K, Q207E, H208Y, R211K, K223E, L228H, I270IV, K277R, E297K N136NT, V276VG, T286AG
>CA13505| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSITNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDQKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQVYAGIKGRQLCKLLRGAKALTEVIPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005