<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5471 CA13545 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 78
2 3TC+AZT 39
3 3TC+AZT+IDV 39
4 D4T+DDI+RTV+SQV 56
5 D4T+DDI+IDV+RTV 92

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82AS L10F, L24I L19I, K55KR, L63P, A71V  
>CA13545| codons 1-99
PQITLWQRPFVTIKIGGQIKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215F K219Q K103KN   K20R, K43R, V60I, K122P, K166R, D177E, G196E, R211RK, D218E, V245T, K277R, T286A, A288S, I293V, P294T, E297K A299AG
>CA13494| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEREGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKSLTEVVTLTKEGE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005