<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5469 CA13543 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 47
2 Unknown 104
3 3TC+D4T+IDV 21
4 NFV+NVP 17
5 3TC+D4T+NFV 69
6 ABC+AZT+RTV+SQV 12
7 APV+DDI+RTV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82VA, I84V, L90M K43T L10I, K20R, E35D, M36I, R57K, Q61E, I62V, L63P, A71I, I72V, I93L  
>CA13543| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWTPKMIGGIGGFLKVKQYD
EVPIEICGHKIVGTVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y V75VA K103N   P4PS, E6D, K20R, V118I, K122E, T200I, Q207E, R211K, D218DG  
>CA13492| codons 1-267
PISSIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVADFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLWKWGFYTPGKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWA

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005