<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRGO3156 BRGO3156 Brazil 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  K43KT I15V, Q18E, K20R, E35D, M36I, R41K, R57K, Q61N, L63T  
>BRGO3156| codons 1-99
PQITLWQRPLVTIKVGGELREALLDTGADDTVLEDINLPGKWTPKMIGGIGGFIKVKQYD
NITIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, D123E, I135V, S162C, K173A, Q174K, I178L, T200TA, Q207E, R211K  
>BRGO3156| codons 1-232
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGY

References
Author Title Citation
Cardoso, LP HIV-1 pol phylogenetic diversity and antiretroviral resistance mutations in treatment naive patients from central west Brazil. J Clin Virol, 2009