<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRGO3094 BRGO3094 Brazil 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I G17D, P39Q, R41K, R57K, D60E, Q61K, I62V, L63P, I64V, A71T, I93L  
>BRGO3094| codons 1-99
PQITLWQRPLVTIKIGDQLKEALLDTGADDTVIEEMNLQGKWKPKMIGGIGGFIKVKQYE
KVPVEICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32R, D121DY, K122E, I135T, S162C, D177E, I178V, V179I, T200A, E204K, Q207E  
>BRGO3094| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEVII
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Cardoso, LP HIV-1 pol phylogenetic diversity and antiretroviral resistance mutations in treatment naive patients from central west Brazil. J Clin Virol, 2009