<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRGO3043 BRGO3043 Brazil 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, E35D, M36I, R41K, R57K, D60E, Q61D, L63P, E65D, C67W, L89M T74TI
>BRGO3043| codons 1-99
PQITLWQRPLVPIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
DIPIDIWGHKAIGIVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135T, D177E, Q197K, I202V  
>BRGO3043| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGKHRTKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Cardoso, LP HIV-1 pol phylogenetic diversity and antiretroviral resistance mutations in treatment naive patients from central west Brazil. J Clin Virol, 2009