<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRGO3024 BRGO3024 Brazil 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35L, V118I, I135V, E138A, S162C, K173T, Q174K, G196GE, Q207D, R211K, F214L  
>BRGO3024| codons 1-235
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRDHLLKWGLTTPDKKHQKEPPFLWMGYELH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, I15V, E35D, M36I, R41K, R57K, Q61N, E65D, I72V, L89M  
>BRGO3024| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIDICGHKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Cardoso, LP HIV-1 pol phylogenetic diversity and antiretroviral resistance mutations in treatment naive patients from central west Brazil. J Clin Virol, 2009