<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4406 CA13482 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC+DDI+NFV 35
2 3TC+ABC+D4T+DDI+NFV+SQV 11
3 3TC+ABC+DDI+NFV+SQV 55
4 EFV+D4T+DDI+APV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M   N37T, K55KR, D60E, Q61E, I62V, L63P, I64V, V77I, I85V, I93L  
>CA13482| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKLIGGIGGFIRVRQYE
EVPVEICGHKAIGTVLIGPTPVNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N   T7TP, K20R, S68G, A158S, D237E, V245Q I270IM, K275KN
>CA13456| codons 1-300
PISPIEPVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPEKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQMYAGINVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005