<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5462 CA13468 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+IDV 69
2 3TC+AZT+IDV 81

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T L10F, L24I E35D, M36I, N37E, L63P, A71V  
>CA13468| codons 1-99
PQITLWQRPFVTIKIGGQLKEALIDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005