<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6468 CA134365 U.S. 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+EFV 24
3 Unknown 461

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215L, K219Q Y181C, G190A V179F E6K, S68G, T69N, K101Q, K122E, D123DN, I135T, E204EK, Q207QH, R211RK, H221Y, A272P, K277R, T286A, E297K  
>CA134365| codons 1-302
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIFI
CQYMDDLYVASDLEIGQHRTKIEKLRHHLLKWGFLTPDQKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  F53LM L10I, T12I, I13V, K20I, M36I, L63PS, I64L, A71V  
>CA134364| codons 1-99
PQITLWQRPIVIVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGMIKVRQYD
QISLEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012