<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-l L39 Spain 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDI 104
2 3TC+D4T+RTV 36
3 3TC+D4T+RTV+SQV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Y115F, Q151M, M184V V75I, F77L, F116Y     T39K, K43E, S68G, T69I, K102Q, K122E, K166R, T200A, R211G, L228Q  
>L39| codons 39-238
KEMEEEGKISKIGPENPYNTPVFAIKRKDGIRWRKLIDLRELNKRTQDFWEVQLGIPHPA
GLKQKKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPA
IFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLGWGFTTPD
KKHQKEPPFQWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, I84V K43T E34K, N37H, R41K, I62V, L63P, I72L  
>L39| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLKEMHLPGKWTPKMIGGIGGFIKVRQYD
QVPIEICGHKALGTVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005