<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-l L0 Spain 1994 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDI 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F77L, F116Y     T39K, K43E, S68G, T69I, K102Q, K122E, K166R, R211G  
>L0| codons 39-238
KEMEEEGKISKIGPENPYNTPVFAIKRKDGIRWRKLIDLRELNKRTQDFWEVQLGIPHPA
GLKQKKSVTVLDVGDAYYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPA
IFQSSMTRILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPD
KKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37H, R41K, I62V, L63P  
>L0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMHLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005