<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-k K24 Spain 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+IDV 36
2 DDC+RTV+SQV 48
3 3TC+D4T+RTV+SQV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, T12E, I15V, L19I, K20R, M36I, I62V, L63S, I64V, A71V  
>K24| codons 1-99
PQITLWQRPIVEIKVGGQIREALLDTGADDTVLEEINLPGRWKPKMIVGIGGFTKVRQYD
QVSVEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V       T69N, K122E, I135T, S163C, D177N, G196E, I202V  
>K24| codons 39-238
TEMEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPA
IFQSCMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFTTPD
KKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005