Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
Treatment History
| Order | Regimen | Weeks |
| 1 | RTV | 28 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A | K20R, E35D, M36I, N37C, L63P |
| >RTV131W28| codons 1-99 PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDICLPGRWKPKMIGGIGGFVKVRQYD QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Molla, A | Ordered accumulation of mutations in HIV protease confers resistance to ritonavir. | Nat Med, 1996 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |