<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-j J0 Spain 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV+SQV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, I84V, L90M   L10V, I15V, K20R, E35D, M36I, L63P, A71V  
>J0| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215Y K70I, K219Q     K103R, K122E, I135T, R211K N54Y, D76Y, K82T
>J0| codons 39-238
TEMEKEGKISKIGPEYPYNTPVFAIKKKNSTIWRKLVYFRELNTRTQDFWEVQLGIPHPA
GLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPD
QKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005