<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-I I40 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 56
2 3TC+AZT+DDI 36
3 IDV 24
4 3TC+D4T+RTV+SQV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219Q     E40F, K43E, V60I, K122E, D123N, I135V, I178M, V179I, G196E, H208Y, R211K, D218E, L228H  
>I40| codons 39-238
TFLEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPA
GLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDMIIYQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPE
QKHQKEPPFHWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10I, Q18H, F53Y, L63P, V77I, I93L, C95F  
>I40| codons 1-99
PQITLWQRPIVTIKIGGHLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGYIKVRQYD
QIPIEICGHKAITTVLIGPTPVNVIGRNLMTQLGFTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005