Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| Cab-I | I33 | Spain | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDI | 56 |
| 2 | 3TC+AZT+DDI | 36 |
| 3 | IDV | 24 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I84V, L90M | G73S | L10I, Q18H, L63P, V77I, I93L, C95F |
| >I33| codons 1-99 PQITLWQRPIVTIKIGGHLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD QIPIEICGHKAISTVLIGPTPVNVIGRNLMTQLGFTLNF |
References
| Author | Title | Citation |
| Cabana, M | Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. | J Med Virol, 1999 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
