<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-h H60 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 112
2 3TC+ AZT+ DDI 40
3 3TC+ DDI+ IDV+ NVP 52
4 3TC+ IDV+ NVP+ SQV 16
5 3TC+ D4T+ IDV+ NVP+ RTV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, Y181C   R83K, A98S, I135T, I142V, S162C, R211K, L228Q I180T
>H60| codons 39-238
TELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPS
GLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPA
IFQCSMTKILEPFRKQNPDIVTCQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPD
KKHQKEPPFQWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48T, I54V, V82A L24I L10I, E35D, M36I, N37D, R41K, I64V, A71V, I72V, I93L  
>H60| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEDIDLPGKWKPKLITGIGGFVKVRQYD
QILVEICGHKVVGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005