<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-h H44 Spain 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 112
2 3TC+ AZT+ DDI 40
3 3TC+ DDI+ IDV+ NVP 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A   L10I, M36I, R41K, I64V, A71V, I93L  
>H44| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKLIGGIGGFVKVRQYD
QILVEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005