Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| Cab-h | H41 | Spain | 1994 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI | 112 |
| 2 | 3TC+ AZT+ DDI | 40 |
| 3 | 3TC+ DDI+ IDV+ NVP | 12 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, V82A | L10I, M36I, R41K, I64V, A71V, I93L |
| >H41| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKLIGGIGGFVKVRQYD QILVEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Cabana, M | Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. | J Med Virol, 1999 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |