<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2605 2004_2605 South Africa 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V35T, E36A, T39E, S48T, K103E, K104N, V118I, K122E, E138A, K173T, Q174K, G196K, T200A, Q207E, R211K, F214L, P243T  
>2004_2605| codons 1-244
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKENSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIKQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQTI

References
Author Title Citation
Pillay, V Antiretroviral drug resistance surveillance among drug-naive HIV-1-infected individuals in Gauteng province, South Africa in 2002 and 2004. Antivir Ther, 2008