<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-g G56 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 80
2 3TC+AZT+RTV 96
3 3TC+D4T+SQV 8
4 3TC+D4T+NVP+SQV 8
5 D4T+DDI+NVP+IDV+SQV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M L33F, G73S L10I, I13V, L63P, E65D, A71V, I72M, V77I D25G, D29H
>G56| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLGTGAHDTVFEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPIDICGHKVMSTVLIGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y181C, G190A   E44D, V111I, V118I, K122E, I135T, E194Q, G196E, E203K, H208Y, R211K, K223Q  
>G56| codons 39-238
TELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKKSVTVLDIGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLQIEQHRTKIKELRQYLWKWGFYTPD
KKHQQEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005