Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| Cab-g | G51 | Spain | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDI | 80 |
| 2 | 3TC+AZT+RTV | 96 |
| 3 | 3TC+D4T+SQV | 8 |
| 4 | 3TC+D4T+NVP+SQV | 8 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A, I84V, L90M | L33F, G73S | L10I, I13V, L63P, A71V, V77I |
| >G51| codons 1-99 PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFVKVRQYD QIPIEICGHKVISTVLIGPTPANVIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Cabana, M | Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. | J Med Virol, 1999 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
