<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-g G51 Spain 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 80
2 3TC+AZT+RTV 96
3 3TC+D4T+SQV 8
4 3TC+D4T+NVP+SQV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M L33F, G73S L10I, I13V, L63P, A71V, V77I  
>G51| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVISTVLIGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005