<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-e E35 Spain 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 56
2 3TC+AZT+DDC 48
3 3TC+AZT+IDV 8
4 3TC+AZT+RTV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73S L10I, R41K, K43R, I62V, L63P, V77I, I93L  
>E35| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGHKAISTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005