<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-d D42 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 52
2 3TC+AZT+DDC 40
3 3TC+AZT+RTV 24
4 3TC+D4T+IDV 24
5 3TC+NVP+IDV+SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, I84V, L90M   L10I, R41K, I62V, L63P, I93L, C95F  
>D42| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPTNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q K103N, Y181C   K43N, T69N, I202V, R211S, D218E L109R
>D42| codons 39-238
TELENEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKNKSVTVRDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKVEELRQHLLSWGFFTPE
QKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005