<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-d D29 Spain 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 52
2 3TC+AZT+DDC 40
3 3TC+AZT+RTV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82S   R41K, I62V, L63P, I93L  
>D29| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     T69N, K104N, R172K, I202V, R211S, D218E  
>D29| codons 39-238
TELEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKNSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLSWGFFTPE
QKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005