<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-c C28 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDC 40
2 3TC+D4T+IDV 28
3 D4T+DDI+NVP 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F N37S, R41K, L63P, K70R, I93L  
>C28| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K64H, T69N, K104R, K122P, I135V, D177E, Q207E S191P
>C28| codons 39-238
TEMEKEGKISKIGPENPYNTPVFAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKRSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGPDLEIGQHRTKIEELREHLLRWGFFTPD
QKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005