<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-b B58 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 112
2 3TC+AZT+DDC 17
3 3TC+AZT+DDC+IDV 40
4 3TC+D4T+RTV+SQV 96

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V   L10I, I13V, K14R, L63P, L89I  
>B58| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVVVGPTPVNVIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y D67E, F77L     E40F, K43E, S68G, V118I, K122P, D123E, I135T, S162C, D177E, Q207E, R211K L149I
>B58| codons 39-238
TFLEEEGKISKIGPENPYNTPVFAIKKKEGTKWRKLMDLRELNKRTQDFWEVQLGIPHPA
GLKKKKSVTVLDVGDAYFSIPLDPEFRKYTAFTIPSTNNETPGIRYQYNVIPQGWKGSPA
IFQCSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPD
KKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005