<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-b B0 Spain 1990 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67E     K43R, S68G, K122P, D123E, I135T, S162C, D177E, R211K  
>B0| codons 39-238
TELEREGKISKIGPENPYNTPVFAIKKKEGTKWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKKSVTVLDVGDAYFSVPLDPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPA
IFQCSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPD
KKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, N37D, L63P, V82I G52R
>B0| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGRFIKVRQYD
QIPIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005