<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Cab-a A18 Spain 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+D4T+SQV NA
2 3TC+D4T+IDV 48
3 DDI+NVP+RTV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   Y181C   K43E, E44D, K49R, V106I, V118I, K122E, I135L, D177N, G196E  
>A18| codons 39-238
TELEEDGKISRIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPNIVICQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPD
KKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M G73S L10I, K20R, E35D, M36I, D60E, I62V, L63P, H69K, A71V, I72V  
>A18| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
QVPIEICGKKVVSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Cabana, M Emergence and genetic evolution of HIV-1 variants with mutations conferring resistance to multiple reverse transcriptase and protease inhibitors. J Med Virol, 1999
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005