<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5423 CA13319 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 61
2 D4T+DDC 57
3 3TC+D4T+SQV 17
4 3TC+D4T+RTV 61
5 D4T+NVP+SQV 78
6 3TC+D4T+RTV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F, L90LM F53FL T4TN, K14KR, I15IV, R41K, D60E, L63P, V75VI  
>CA13319| codons 1-99
PQINLWQRPLVTIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGLIKVRQYE
QIPIEICGHKAIGTILVGPTPFNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K11KQ, D17DG, I31IV, W88C, D121H, K122E, I135T, D177E, R211K W24WG
>CA13157| codons 1-254
PISPIETVPVQLKPGMGGPKVKQGPLTEEKVKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009