<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5410 CA13306 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 3TC+DDC+IDV 26
3 3TC+DDC+SQV 21
4 3TC+D4T+NFV 124

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, K43R, Q61E, L63P, T74S, V77I, I93L  
>CA13306| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGSVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y A62V     V35L, T39A, K122E, T139K, E169D, K173E, I178L, G196E, T200A, Q207E, A272P, K277R, I293V P140T
>CA13142| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEKTGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFREQNPDLVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005