<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2076 CA13287 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 31
2 D4T+IDV 48
3 D4T+NFV+NVP 23
4 3TC+AZT+NFV+NVP 10
5 3TC+ABC+AZT+EFV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L V11VI K14E, K20T, E35G, M36I, R41RK, R57K, Q61E, I62V, L63P, E65N, A71V, T74TS, Q92QK, I93L L10CR
>CA13287| codons 1-99
PQITLWQRPCITIEIGGQLTEALLDTGADDTVLEGINLPGKWKPKLIGGIGGFIKVKQYD
EVPINICGHKVIGSVLVGPTPVNIIGRNLLTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y188L   K43E, E44A, K102M, V118I, K122KE, R211N, A272P, E291D, I293V  
>CA13122| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLWNWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009