<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5392 CA13284 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 30
2 D4T+3TC 52
3 D4T+3TC+NFV 123

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12E, K14R, I62V, T74S, V77I  
>CA13284| codons 1-99
PQITLWQRPLVEIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVLIEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6D, V35I, G196E, R211RG  
>CA13120| codons 1-252
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001