<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5354 CA13265 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+ AZT 104
3 3TC+ AZT+ IDV 34
4 D4T+ DDI+ RTV+ SQV 17
5 AZT+ D4T+ NVP 52
6 D4T+ DDI+ EFV+ IDV+ RTV 4
7 D4T+ DDI+ EFV+ IDV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V V32T, L33F L10I, I13V, I15IV, M36MI, I64V, A71V R8RG
>CA13265| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTTFEEINLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHKVIGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M V106A, G190A F227L E44D, V60I, W88C, V118I, K122E, I135M, I178M, I195L, G196E, E203K, H208Y, R211K, K223E, V245E, A272P, K277R, E297K V292VG
>CA13077| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFCEVQLGIPHPAGLKKKKSATVLDVGDAYFSIPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVASDLELEQHRTKIKELRQYLWKWGFYTPDKKHQEEPPLLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEGIPLTKEAE
L

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005