<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA634 CA13259 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDI 157
3 D4T 104
4 AZT+DDC+SQV 13
5 3TC+D4T+IDV 56
6 3TC+NVP 5
7 3TC+AZT+RTV+SQV 37
8 3TC+AZT+EFV+RTV+SQV+Unknown 16
9 3TC+AZT+DDI+EFV+RTV+SQV+Unknown 26
10 3TC+AZT+EFV+IDV+RTV+SQV+Unknown 8
11 3TC+AZT+DDI+EFV+IDV+RTV+Unknown 11
12 3TC+AZT+DDI+IDV+RTV+Unknown 14
13 DDI+IDV+RTV 9
14 3TC+DDI+IDV+RTV 4
15 None 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82A K43T L10I, I15V, K20R, E35D, M36I, N37D, I62IV, L63P, A71V, V77I, I93L  
>CA13259| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGRWTPKIIVGIGGFTKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215F V75M K103N V108I, V179E E6EK, K43E, E44A, W88C, V118I, K122E, I135V, I142V, D177E, I178M, D192DN, G196E, T200A, E203D, H208Y, R211DN, H221Y, A272P, A288S V189IM, K281KE
>CA13099| codons 1-303
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDFRELNKRTQDFCEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMEI
YQYVDDLYIGSNLEIEQHRAKIDELRQYLWDWGFFTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCELLRGTKSLTEVIPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005