<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5359 CA13246 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 99
2 3TC+AZT 13
3 3TC+AZT+RTV 56
4 3TC+D4T+NFV 13
5 3TC+DDC+DLV+NFV 26
6 3TC+D4T+DLV+IDV 25
7 3TC+D4T+DLV+RTV 34
8 None 13
9 3TC+APV+D4T+EFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M K43T L10I, I15IL, K20KT, A22AV, E35D, M36I, I62V, L63P, A71V, T74S, I93L  
>CA13246| codons 1-99
PQITLWQRPIVTIKLGGQLTEVLLDTGADDTVLEDINLPGRWTPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219N L100LI, K103N   E6D, T39E, E44D, V60I, V118I, I142V, Q174K, I178L, T200R, E203EK, Q207E, H208Y, R211K, K223E, A272P, T286A, I293V, E297EQ K281K*
>CA13083| codons 1-302
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDLVI
YQYVDDLYVGSDLEIGQHRRKIKELREYLWKWGFYTPDNKHQEEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLC*LLRGAKALTEVVPLTQEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005