<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TW3641 TW3641 Taiwan 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215D     E6D, S68G, K103R, I135V, T200TA, Q207E, L210F, R211K, F214L  
>TW3641| codons 1-246
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLFKWGLDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, L63P, K70T, I72IV, I93L  
>TW3641| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHTAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Chang, SY Trends of antiretroviral drug resistance in treatment-naive patients with human immunodeficiency virus type 1 infection in Taiwan. J Antimicrob Chemother, 2008