<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5350 CA13235 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 213
2 DDI 91
3 D4T 61
4 AZT+DDC+IDV 60
5 3TC+AZT+IDV 17
6 3TC+D4T+NVP 47
7 ABC+RTV+SQV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T, L90M G73GS L10V, I13V, I15V, K45R, I62V, L63P, A71V  
>CA13235| codons 1-99
PQITLWQRPVVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q     K20KR, T27TS, V35T, T39A, V60I, T69TN, K122E, I135T, T139M, G196E, E203EG, H221HL R72RG
>CA13071| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALTEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSNRWGKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIGELRQHLLRWGFFTPDQKLQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005