<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5348 CA13232 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 107

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D E35D, M36I, R41K, L63P, V77I, I93L  
>CA13232| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K32KR, V35IM, R72X, I135V, Q174R, R211K, V245M, E248Q, A272P, K277R, L283I, V292I, I293V A299AG
>CA13069| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWXKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEIVPLTEEGE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001