<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1492 CA13222 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 74
2 DDC+DDI 61
3 AZT+DDC 31
4 DDC 104
5 3TC+D4T 48
6 3TC+NVP 4
7 EFV+IDV 22
8 3TC+AZT+EFV+IDV 51
9 D4T+DDI+NFV+SQV 33
10 D4T+DDI+NFV 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M T74P I15V, K43R, Q61E, I62V, L63P, I72V, I93L R8RG, D25DV, A28AP
>CA13222| codons 1-99
PQITLWQGPLVTIKVGGQLKEALLVTGPDDTVLEEMNLPGRWRPKIIGGIGGFIKVRQYD
EVPIEICGHKAVGPVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103KN   K20R, K49KR, K122E, K126KR, I135IL, D177G, Q207E, R211K, A272P, Q278QH, T286TA N137S, E138E*
>CA13061| codons 1-290
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRRYTAFTIPSLNS*TPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALT

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009