<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5195 CA13203 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 208
2 SQV+ RTV+ DDC 73
3 NVP+ NFV+ D4T 123

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F K43T L10I, I13V, I15IV, E35D, M36I, N37S, D60E, I62V, L63T, I64V, I72V, V77I  
>CA13203| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDISLPGRWTPKMIGGIGGFVKVRQYE
QVTVEICGHKAVGTVLIGPTPFNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR V106A F227L K20R, V35IL, T39AS, E44D, V90I, V118I, K122E, E203K, Q207E, H208Y, R211K, K223E, K277R, Q278H, R284K, A288S, I293V  
>CA12495| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSATVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDRKHQEEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLKGTKSLTEVVPLTEEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005