<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
139339y 139339y Uganda 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 1
2 None 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, N37ND, R41K, L63P, E65D, K70R, A71AT, I72IT, V77VI  
>139339y| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEEMDLPGKWKPKMIGGIGGFIKVRQYD
QIPIDICGHRTTGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39KR, K49R, V60I, D121Y, K122E, I135IT, D177E, I178M, V179I, G196KR, I202IV, Q207E, R211K, V245K, D250E, A272P, K277R, T286AV  
>139339y| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICREMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYMDDLYVGSDLEIRQHRTKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGVKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Eshleman, SH Survival of Ugandan infants with subtype A and D HIV-1 infection (HIVNET 012). JAIDS, 2002