<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
132074m 132074m Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 1
2 None 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20KR, V21VI, V35T, T39TR, E40ED, K43KE, V60VI, K122E, D123N, I135IT, K173S, Q174K, D177EG, V179I, T200A, I202IV, R206RK, Q207RS, R211NS, F214FL, V245Q, E248ED, T286A, E291D, V292VI, I293V, E312D  
>132074m| codons 1-324
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICRDMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPGIII
YQYMDDLYVGSDLEIGQHRAKVEELKSHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, R57K, L63LP, H69K, L89M  
>132074m| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Eshleman, SH Survival of Ugandan infants with subtype A and D HIV-1 infection (HIVNET 012). JAIDS, 2002