<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
115106j 115106j Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT 1
2 None 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11KT, V35T, T39A, E40D, K43R, K64R, K122E, D123S, I135R, K173AS, D177E, V179I, T200A, Q207A, R211S, F214L, V245Q, A272S, T286TA, E291D, I293V, P294T, L310LI, E312D  
>115106j| codons 1-324
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICADMEREGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREIIKDPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10IV, I13V, K14R, E35D, M36I, R41K, K45R, R57K, L63LP, H69K, K70KR, L89M  
>115106j| codons 1-99
PQITLWQRPVVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Eshleman, SH Survival of Ugandan infants with subtype A and D HIV-1 infection (HIVNET 012). JAIDS, 2002