<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA371 CA13190 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV 24
2 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A M46V L10I, K14KR, N37H, L63P, A71V, T74S, V77I, I93L  
>CA13190| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMHLPGRWKPKVIVGIGGFTKVRQYD
QIPIEICGHKVIGSVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K101P, K103N   T39A, K49E, K122E, I142R, E169D, D177N, I178M, V179VG, G196E, V245T, A272P, K277R  
>CA13030| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISEIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGRRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPNMGI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005