<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5311 CA13179 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 83
2 D4T+DDI 57
3 3TC+D4T 65
4 DLV+NFV+SQV 65
5 3TC+D4T+EFV+IDV 30
6 None 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19IT, E35D, L63P, V77I, I93L  
>CA13179| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N T215C, K219E K103N   T39A, V60I, R83RK, S162Y, K173Q, T200TP, Q207R, R211Q  
>CA13020| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRQQNPDIVI
YQYMDDLYVGSDLEIGQHRPKIEELRRHLLQWGFCTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001