<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1625 CA13140 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 108
2 D4T+ DDI+ NFV 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, Q151M       K22R, K122E, D123E, I135V, I142V, T200A, I202V, V245M, K277R, Q278E, T286A, I293V, E297T  
>CA13140| codons 1-304
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGAKALTEVVPLTTEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L10LF L5LF, E34D, M36V, L63P, I93IL  
>CA13280| codons 1-99
PQITFWQRPFVTIKIGGQLKEALLDTGADDTVLDEVNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005