<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3910 CA13134 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 72
2 AZT+ D4T 29
3 3TC+ SQV+ AZT 67
4 D4T+ 3TC+ NFV 32
5 RTV+ SQV+ NVP 70
6 EFV+ DDI 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   Y181C, G190A V179D E6EK, K20R, V35T, T39A, K43Q, E44D, K102Q, K103R, L109M, K122E, Q207E, H208Y, R211K, T286P  
>CA13134| codons 1-292
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQRKSVTVMDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
CQYMDDLYVASDLEIGQHRTKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKALTEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    P39A, L63P  
>CA13300| codons 16-99
GGQLKEALLDTGADDTVLEEMNLAGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTV
LVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009